CAPZB (NM_004930) Human Recombinant Protein
CAT#: TP310480
Recombinant protein of human capping protein (actin filament) muscle Z-line, beta (CAPZB), 20 µg
View other "CAPZB" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 6,281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210480 representing NM_004930
Red=Cloning site Green=Tags(s) MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDS YRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDG SKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHI ANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004921 |
Locus ID | 832 |
UniProt ID | P47756 |
Refseq Size | 1647 |
Cytogenetics | 1p36.13 |
Refseq ORF | 816 |
Synonyms | CAPB; CAPPB; CAPZ |
Summary | This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast growing (barbed) filament ends and functions in regulating actin filament dynamics as well as in stabilizing actin filament lengths in muscle and nonmuscle cells. A pseudogene of this gene is located on the long arm of chromosome 2. Multiple alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417647 | CAPZB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417647 | Transient overexpression lysate of capping protein (actin filament) muscle Z-line, beta (CAPZB) |
CNY 3,080.00 |
|
PH310480 | CAPZB MS Standard C13 and N15-labeled recombinant protein (NP_004921) |
CNY 19,520.00 |