RBM35A (ESRP1) (NM_001034915) Human Recombinant Protein
CAT#: TP310539
Recombinant protein of human epithelial splicing regulatory protein 1 (ESRP1), transcript variant 2, 20 µg
View other "RBM35A" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210539 protein sequence
Red=Cloning site Green=Tags(s) MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKI DVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLR KEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF ESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRD LALQRHKHHMGTRYIEVYKATGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHC PITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSAP LIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGD AFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSPPPCLSPPSYTFPAPAA VIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMNYTAYYPSPPGSPNSLGYFPTAANLSGVPPQPGTV VRMQGLAYNTGVKEILNFSQGYQYATEDGLIHTNDQARTLPKEWVCI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 75 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001030087 |
Locus ID | 54845 |
UniProt ID | Q6NXG1 |
Refseq Size | 3794 |
Cytogenetics | 8q22.1 |
Refseq ORF | 2031 |
Synonyms | DFNB109; RBM35A; RMB35A |
Summary | ESPR1 is an epithelial cell-type-specific splicing regulator (Warzecha et al., 2009 [PubMed 19285943]).[supplied by OMIM, Aug 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413607 | ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422113 | ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426568 | ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426569 | ESRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413607 | Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 1 |
CNY 3,080.00 |
|
LY422113 | Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 2 |
CNY 3,080.00 |
|
LY426568 | Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 3 |
CNY 3,080.00 |
|
LY426569 | Transient overexpression lysate of epithelial splicing regulatory protein 1 (ESRP1), transcript variant 5 |
CNY 3,080.00 |
|
PH309131 | ESRP1 MS Standard C13 and N15-labeled recombinant protein (NP_060167) |
CNY 14,250.00 |
|
PH310539 | ESRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001030087) |
CNY 19,520.00 |
|
TP309131 | Recombinant protein of human epithelial splicing regulatory protein 1 (ESRP1), transcript variant 1, 20 µg |
CNY 2,900.00 |