NIT2 (NM_020202) Human Recombinant Protein
CAT#: TP310660
Recombinant protein of human nitrilase family, member 2 (NIT2), 20 µg
View other "NIT2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210660 protein sequence
Red=Cloning site Green=Tags(s) MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme activity (PMID: 28358347) |
Reference Data | |
RefSeq | NP_064587 |
Locus ID | 56954 |
UniProt ID | Q9NQR4, V9HW91 |
Refseq Size | 1271 |
Cytogenetics | 3q12.2 |
Refseq ORF | 828 |
Synonyms | HEL-S-8a |
Summary | Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The Enzymology of 2-Hydroxyglutarate, 2-Hydroxyglutaramate and 2-Hydroxysuccinamate and Their Relationship to Oncometabolites
,Hariharan, VA;Denton, TT;Paraszcszak, S;McEvoy, K;Jeitner, TM;Krasnikov, BF;Cooper, AJ;,
Biology (Basel) 2017
,PubMed ID 28358347
[NIT2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402761 | NIT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402761 | Transient overexpression lysate of nitrilase family, member 2 (NIT2) |
CNY 3,080.00 |
|
PH310660 | NIT2 MS Standard C13 and N15-labeled recombinant protein (NP_064587) |
CNY 19,520.00 |