PRPSAP2 (NM_002767) Human Recombinant Protein
CAT#: TP310719
Recombinant protein of human phosphoribosyl pyrophosphate synthetase-associated protein 2 (PRPSAP2), 20 µg
View other "PRPSAP2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210719 protein sequence
Red=Cloning site Green=Tags(s) MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGK DVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLT HLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVI HGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLA AAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIR RIHNGESMSYLFRNIGLDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002758 |
Locus ID | 5636 |
UniProt ID | O60256 |
Refseq Size | 2021 |
Cytogenetics | 17p11.2 |
Refseq ORF | 1107 |
Synonyms | PAP41 |
Summary | This gene encodes a protein that associates with the enzyme phosphoribosylpyrophosphate synthetase (PRS). PRS catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400988 | PRPSAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400988 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase-associated protein 2 (PRPSAP2) |
CNY 3,080.00 |
|
PH310719 | PRPSAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002758) |
CNY 19,520.00 |
其它PRPSAP2产品