WW domain binding protein 4 (WBP4) (NM_007187) Human Recombinant Protein
CAT#: TP310721
Recombinant protein of human WW domain binding protein 4 (formin binding protein 21) (WBP4), 20 µg
View other "WW domain binding protein 4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210721 protein sequence
Red=Cloning site Green=Tags(s) MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEA AALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYY YDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVN ENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGS NEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMAD GVAPVFKKRRTENGKSRNLRQRGDDQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009118 |
Locus ID | 11193 |
UniProt ID | O75554 |
Refseq Size | 2354 |
Cytogenetics | 13q14.11 |
Refseq ORF | 1128 |
Synonyms | FBP21 |
Summary | This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A reference library for assigning protein subcellular localizations by image-based machine learning
,null,
The Journal of Cell Biology
,PubMed ID 31968357
[WBP4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416138 | WBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416138 | Transient overexpression lysate of WW domain binding protein 4 (formin binding protein 21) (WBP4) |
CNY 3,080.00 |
|
PH310721 | WBP4 MS Standard C13 and N15-labeled recombinant protein (NP_009118) |
CNY 19,520.00 |
其它WW domain binding protein 4产品