Coronin 1a (CORO1A) (NM_007074) Human Recombinant Protein
CAT#: TP310753
Recombinant protein of human coronin, actin binding protein, 1A (CORO1A), 20 µg
View other "Coronin 1a" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210753 protein sequence
Red=Cloning site Green=Tags(s) MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRV DKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWH TTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTV VAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTN IVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAM TVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPE ASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009005 |
Locus ID | 11151 |
UniProt ID | P31146 |
Refseq Size | 1825 |
Cytogenetics | 16p11.2 |
Refseq ORF | 1383 |
Synonyms | CLABP; CLIPINA; HCORO1; IMD8; p57; TACO |
Summary | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16. [provided by RefSeq, Sep 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402085 | CORO1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402085 | Transient overexpression lysate of coronin, actin binding protein, 1A (CORO1A) |
CNY 3,080.00 |
|
PH310753 | CORO1A MS Standard C13 and N15-labeled recombinant protein (NP_009005) |
CNY 19,520.00 |
其它Coronin 1a产品