United States
Germany
Japan
United Kingdom
China
PDE4 (PDE4B) (NM_001037341) Human Recombinant Protein
CAT＃: TP310912
Recombinant protein of human phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant d, 20 µg
View other "PDE4" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210912 protein sequence
Red=Cloning site Green=Tags(s) MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQSERARTPEGDG ISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVLHATFPGHSQRRESFLYRSDS DYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVRNNFTILTNLHGTSNKRSPAASQPPVSRVNP QEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFL DKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGL NIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEE HCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMV HCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETW ADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHS YFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 83.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001032418 |
| Locus ID | 5142 |
| UniProt ID | Q07343 |
| Refseq Size | 4309 |
| Cytogenetics | 1p31.3 |
| Refseq ORF | 2208 |
| Synonyms | DPDE4; PDEIVB |
| Summary | This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. The encoded protein regulates the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome |
| Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400417 | PDE4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC400919 | PDE4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC421908 | PDE4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400417 | Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant b |
CNY 4,840.00 |
|
| LY400919 | Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant a |
CNY 4,840.00 |
|
| LY421908 | Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant d |
CNY 3,080.00 |
|
| PH310912 | PDE4B MS Standard C13 and N15-labeled recombinant protein (NP_001032418) |
CNY 19,520.00 |
|
| PH311956 | PDE4B MS Standard C13 and N15-labeled recombinant protein (NP_002591) |
CNY 19,520.00 |
|
| TP311956 | Recombinant protein of human phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant a, 20 µg |
CNY 2,900.00 |
