SDR O (SDR9C7) (NM_148897) Human Recombinant Protein
CAT#: TP310941
Recombinant protein of human short chain dehydrogenase/reductase family 9C, member 7 (SDR9C7), 20 µg
View other "SDR O" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210941 protein sequence
Red=Cloning site Green=Tags(s) MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTS YRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEV TLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAIL GKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPG LDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_683695 |
Locus ID | 121214 |
UniProt ID | Q8NEX9 |
Refseq Size | 1765 |
Cytogenetics | 12q13.3 |
Refseq ORF | 939 |
Synonyms | ARCI13; RDHS; SDR-O; SDRO |
Summary | This gene encodes a protein with similarity to the short-chain dehydrogenase/reductase (SDR) family but has not been shown to have retinoid or dehydrogenase activities. [provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407754 | SDR9C7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407754 | Transient overexpression lysate of short chain dehydrogenase/reductase family 9C, member 7 (SDR9C7) |
CNY 3,080.00 |
|
PH310941 | SDR9C7 MS Standard C13 and N15-labeled recombinant protein (NP_683695) |
CNY 19,520.00 |