Apolipoprotein L 1 (APOL1) (NM_003661) Human Recombinant Protein
CAT#: TP311114
Recombinant protein of human apolipoprotein L, 1 (APOL1), transcript variant 1, 20 µg
View other "Apolipoprotein L 1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>Peptide sequence encoded by RC211114
Blue=ORF Red=Cloning site Green=Tag(s) MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIE DAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRN WFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVL LEPGMELGITAALTGITSSTMDYGKKWWTQAQAHDLVIKSLDKLKEVREFLGENISNFLSLAGNTYQLT RGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFL VLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL myc-FLAG tag Recombinant protein using RC211114 also available, TP311114 |
Tag | C-Myc/DDK |
Predicted MW | 41.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003652 |
Locus ID | 8542 |
UniProt ID | O14791, Q2KHQ6 |
Refseq Size | 2795 |
Cytogenetics | 22q12.3 |
Refseq ORF | 1194 |
Synonyms | APO-L; APOL; APOL-I; FSGS4 |
Summary | This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008] |
Protein Families | Secreted Protein, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Most ApoL1 Is Secreted by the Liver
,null,
Journal of the American Society of Nephrology : JASN
,PubMed ID 27932478
[APOL1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407931 | APOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418517 | APOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427915 | APOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407931 | Transient overexpression lysate of apolipoprotein L, 1 (APOL1), transcript variant 2 |
CNY 3,080.00 |
|
LY418517 | Transient overexpression lysate of apolipoprotein L, 1 (APOL1), transcript variant 1 |
CNY 3,080.00 |
|
LY427915 | Transient overexpression lysate of apolipoprotein L, 1 (APOL1), transcript variant 3 |
CNY 3,080.00 |
|
PH311114 | APOL1 MS Standard C13 and N15-labeled recombinant protein (NP_003652) |
CNY 19,520.00 |
其它Apolipoprotein L 1产品