TNFSF9 (NM_003811) Human Recombinant Protein
CAT#: TP311160
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9), 20 µg
View other "TNFSF9" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,999.00
CNY 2,700.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211160 protein sequence
Red=Cloning site Green=Tags(s) MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRL REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGV YYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQ RLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003802 |
Locus ID | 8744 |
UniProt ID | P41273 |
Refseq Size | 1680 |
Cytogenetics | 19p13.3 |
Refseq ORF | 762 |
Synonyms | 4-1BB-L; CD137L; TNLG5A |
Summary | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.[provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418412 | TNFSF9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418412 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9) |
CNY 3,080.00 |
|
PH311160 | TNFSF9 MS Standard C13 and N15-labeled recombinant protein (NP_003802) |
CNY 19,520.00 |
|
TP700282 | Purified recombinant protein of human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9), with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP721145 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9) |
CNY 3,140.00 |
|
TP723968 | Human 4-1BB Ligand Protein, mFc-His Tag |
CNY 4,925.00 |