NFKBIL1 (NM_005007) Human Recombinant Protein
CAT#: TP311251
Recombinant protein of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 1 (NFKBIL1), transcript variant 1, 20 µg
View other "NFKBIL1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211251 protein sequence
Red=Cloning site Green=Tags(s) MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLDVDAGQPPPLH RACARHDAPALCLLLRLGADPAHQDRHGDTALHAAARQGPDAYTDFFLPLLSRCPSAMGIKNKDGETPGQ ILGWGPPWDSAEEEEEDDASKEREWRQKLQGELEDEWQEVMGRFEGDASHETQEPESFSAWSDRLAREHA QKCQQQQREAEGSCRPPRAEGSSQSWRQQEEEQRLFRERARAKEEELRESRARRAQEALGDREPKPTRAG PREEHPRGAGRGSLWRFGDVPWPCPGGGDPEAMAAALVARGPPLEEQGALRRYLRVQQVRWHPDRFLQRF RSQIETWELGRVMGAVTALSQALNRHAEALK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004998 |
Locus ID | 4795 |
UniProt ID | Q9UBC1, A8K778 |
Refseq Size | 1510 |
Cytogenetics | 6p21.33 |
Refseq ORF | 1143 |
Synonyms | IKBL; NFKBIL |
Summary | This gene encodes a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417580 | NFKBIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428610 | NFKBIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417580 | Transient overexpression lysate of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 1 (NFKBIL1), transcript variant 1 |
CNY 3,080.00 |
|
LY428610 | Transient overexpression lysate of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 1 (NFKBIL1), transcript variant 4 |
CNY 3,080.00 |
|
PH311251 | NFKBIL1 MS Standard C13 and N15-labeled recombinant protein (NP_004998) |
CNY 19,520.00 |
其它NFKBIL1产品