FAM195B (MCRIP1) (NM_207368) Human Recombinant Protein
CAT#: TP311513
Recombinant protein of human hypothetical protein LOC348262 (LOC348262), transcript variant 1, 20 µg
View other "FAM195B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211513 representing NM_207368
Red=Cloning site Green=Tags(s) MHGEKSHGRGQAGRQVPLKQQSVSGESQQGARQGAGQSTCYLSSAFLCNGSFPAGSMSLWDPQPKQAFPS VLWCSWAGVPGRRTGQRDPRVQERRGDFVSKLGAAVGGEPLALFGPHSWPGMGHRVPGLGAGFLLFAGFA LEPWDSYHVVFEGWTIDMRRNEPERTRSLSAPGPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997251 |
Locus ID | 348262 |
UniProt ID | C9JLW8, A0A024R8R5 |
Refseq Size | 2980 |
Cytogenetics | 17q25.3 |
Refseq ORF | 525 |
Synonyms | FAM195B; GRAN2; MCRIP |
Summary | The phosphorylation status of MCRIP1 functions as a molecular switch to regulate epithelial-mesenchymal transition. Unphosphorylated MCRIP1 binds to and inhibits the transcriptional corepressor CTBP(s). When phosphorylated by MAPK/ERK, MCRIP1 releases CTBP(s) resulting in transcriptional silencing of the E-cadherin gene and induction of epithelial-mesenchymal transition (PubMed:25728771).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403988 | FAM195B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403988 | Transient overexpression lysate of family with sequence similarity 195, member B (FAM195B), transcript variant 1 |
CNY 3,080.00 |
|
PH311513 | FAM195B MS Standard C13 and N15-labeled recombinant protein (NP_997251) |
CNY 19,520.00 |
其它FAM195B产品