Septin 2 (SEPT2) (NM_001008492) Human Recombinant Protein
CAT#: TP311650
Purified recombinant protein of Homo sapiens septin 2 (SEPT2), transcript variant 3, 20 µg
View other "Septin 2" proteins (15)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211650 protein sequence
Red=Cloning site Green=Tags(s) MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVISG AAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH IIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG DGDGGALGHHV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008492 |
Locus ID | 4735 |
UniProt ID | Q15019 |
Refseq Size | 3408 |
Cytogenetics | 2q37.3 |
Refseq ORF | 1083 |
Synonyms | DIFF6; hNedd5; NEDD-5; NEDD5; Pnutl3; SEPT2 |
Summary | Filament-forming cytoskeletal GTPase. Forms a filamentous structure with SEPTIN12, SEPTIN6, SEPTIN2 and probably SEPTIN4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation (PubMed:25588830). Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium by maintaining polyglutamylated microtubules, thus facilitating efficient vesicle transport, and by impeding MAP4 binding to tubulin. Required for the progression through mitosis. Forms a scaffold at the midplane of the mitotic splindle required to maintain CENPE localization at kinetochores and consequently chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes: probably acts by regulating the assembly of the tectonic-like complex (also named B9 complex) by localizing TMEM231 protein. May play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416834 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418011 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423437 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423438 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425241 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416834 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 2 |
CNY 3,080.00 |
|
LY418011 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 4 |
CNY 3,080.00 |
|
LY423437 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 1 |
CNY 3,080.00 |
|
LY423438 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 3 |
CNY 3,080.00 |
|
LY425241 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 1 |
CNY 3,080.00 |
|
PH304867 | SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_004395) |
CNY 19,520.00 |
|
PH311473 | SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_006146) |
CNY 14,250.00 |
|
PH311650 | SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_001008492) |
CNY 14,250.00 |
|
TP304867 | Recombinant protein of human septin 2 (SEPT2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP311473 | Purified recombinant protein of Homo sapiens septin 2 (SEPT2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Septin 2产品