RNF22 (TRIM3) (NM_033278) Human Recombinant Protein
CAT#: TP311928
Recombinant protein of human tripartite motif-containing 3 (TRIM3), transcript variant 2, 20 µg
View other "RNF22" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211928 representing NM_033278
Red=Cloning site Green=Tags(s) MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPE QGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRA GEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQ ALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAA LAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDK DGRLVRTGSAELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALR PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQ GVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIF SPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAV NNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSG SFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 80.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_150594 |
Locus ID | 10612 |
UniProt ID | O75382 |
Refseq Size | 2894 |
Cytogenetics | 11p15.4 |
Refseq ORF | 2232 |
Synonyms | BERP; HAC1; RNF22; RNF97 |
Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409625 | TRIM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416642 | TRIM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY409625 | Transient overexpression lysate of tripartite motif-containing 3 (TRIM3), transcript variant 2 |
CNY 3,080.00 |
|
LY416642 | Transient overexpression lysate of tripartite motif-containing 3 (TRIM3), transcript variant 1 |
CNY 4,840.00 |
|
PH311739 | TRIM3 MS Standard C13 and N15-labeled recombinant protein (NP_006449) |
CNY 19,520.00 |
|
PH311928 | TRIM3 MS Standard C13 and N15-labeled recombinant protein (NP_150594) |
CNY 19,520.00 |
|
TP311739 | Recombinant protein of human tripartite motif-containing 3 (TRIM3), transcript variant 1, 20 µg |
CNY 2,900.00 |