SMUG1 (NM_014311) Human Recombinant Protein
CAT#: TP312141
Recombinant protein of human single-strand-selective monofunctional uracil-DNA glycosylase 1 (SMUG1), 20 µg
View other "SMUG1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212141 representing NM_014311
Red=Cloning site Green=Tags(s) MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVT RYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGAR FWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLV VGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055126 |
Locus ID | 23583 |
UniProt ID | Q53HV7, A0A024RAZ8 |
Refseq Size | 1570 |
Cytogenetics | 12q13.13 |
Refseq ORF | 810 |
Synonyms | FDG; HMUDG; UNG3 |
Summary | This gene encodes a protein that participates in base excision repair by removing uracil from single- and double-stranded DNA. Many alternatively spliced transcript variants exist for this gene; the full-length nature is known for some but not all of the variants. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Base excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415367 | SMUG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415367 | Transient overexpression lysate of single-strand-selective monofunctional uracil-DNA glycosylase 1 (SMUG1) |
CNY 3,080.00 |
|
PH312141 | SMUG1 MS Standard C13 and N15-labeled recombinant protein (NP_055126) |
CNY 19,520.00 |