United States
Germany
Japan
United Kingdom
China
Estrogen Related Receptor gamma (ESRRG) (NM_206594) Human Recombinant Protein
CAT＃: TP312143
Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 2, 20 µg
View other "Estrogen Related Receptor gamma" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 3 publications. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212143 representing NM_206594
Red=Cloning site Green=Tags(s) MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGG SGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS CPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKP YNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQS AWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIA LANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGK VPMHKLFLEMLEAKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | WB positive control (PMID: 25496115) WB positive control (PMID: 27363015) |
| Reference Data | |
| RefSeq | NP_996317 |
| Locus ID | 2104 |
| UniProt ID | P62508 |
| Refseq Size | 5369 |
| Cytogenetics | 1q41 |
| Refseq ORF | 1305 |
| Synonyms | ERR-gamma; ERR3; ERRg; ERRgamma; NR3B3 |
| Summary | This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5' end and some of which encode protein isoforms differing in the N-terminal region. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Citations (3)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Antimitotic activity of DY131 and the estrogen-related receptor beta 2 (ERRβ2) splice variant in breast cancer
,Heckler, MM;Zeleke, TZ;Divekar, SD;Fernandez, AI;Tiek, DM;Woodrick, J;Farzanegan, A;Roy, R;Üren, A;Mueller, SC;Riggins, RB;,
Oncotarget
,PubMed ID 27363015
[ESRRG]
|
|
ERRß Splice Variants Differentially Regulate Cell Cycle Progression
,Heckler, MM;Riggins, RB;,
Cell Cycle
,PubMed ID 25496115
[ESRRG]
|
|
ERK/MAPK regulates ERRγ expression, transcriptional activity, and receptor-mediated Tamoxifen resistance in ER+ breast cancer
,null,
The FEBS journal
,PubMed ID 24684682
[ESRRG]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400557 | ESRRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC404215 | ESRRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400557 | Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 1 |
CNY 4,840.00 |
|
| LY404215 | Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 2 |
CNY 4,840.00 |
|
| PH312143 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996317) |
CNY 19,520.00 |
|
| PH314462 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996318) |
CNY 14,250.00 |
|
| PH318233 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001429) |
CNY 19,520.00 |
|
| PH325714 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001127757) |
CNY 14,250.00 |
|
| TP314462 | Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP318233 | Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP325714 | Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP762660 | Purified recombinant protein of Human estrogen-related receptor gamma (ESRRG), transcript variant 1 |
CNY 2,480.00 |
其它Estrogen Related Receptor gamma产品
