CAPNS1 (NM_001749) Human Recombinant Protein
CAT#: TP312322
Recombinant protein of human calpain, small subunit 1 (CAPNS1), transcript variant 1, 20 µg
View other "CAPNS1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212322 representing NM_001749
Red=Cloning site Green=Tags(s) MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGGVISAIS EAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFG IDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLY NMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001740 |
Locus ID | 826 |
UniProt ID | P04632 |
Refseq Size | 1492 |
Cytogenetics | 19q13.12 |
Refseq ORF | 804 |
Synonyms | CALPAIN4; CANP; CANPS; CAPN4; CDPS; CSS1 |
Summary | This gene is a member of the calpain small subunit family. Calpains are calcium-dependent cysteine proteinases that are widely distributed in mammalian cells. Calpains operate as heterodimers, comprising a specific large catalytic subunit (calpain 1 subunit in Calpain I, and calpain 2 subunit in Calpain II), and a common small regulatory subunit encoded by this gene. This encoded protein is essential for the stability and function of both calpain heterodimers, whose proteolytic activities influence various cellular functions including apoptosis, proliferation, migration, adhesion, and autophagy. Calpains have been implicated in neurodegenerative processes, such as myotonic dystrophy. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419767 | CAPNS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419767 | Transient overexpression lysate of calpain, small subunit 1 (CAPNS1), transcript variant 1 |
CNY 3,080.00 |
|
PH303233 | CAPNS1 MS Standard C13 and N15-labeled recombinant protein (NP_001003962) |
CNY 19,520.00 |
|
PH312322 | CAPNS1 MS Standard C13 and N15-labeled recombinant protein (NP_001740) |
CNY 19,520.00 |
|
TP303233 | Recombinant protein of human calpain, small subunit 1 (CAPNS1), transcript variant 2, 20 µg |
CNY 2,900.00 |