Amino terminal enhancer of split (AES) (NM_198970) Human Recombinant Protein
CAT#: TP313043
Purified recombinant protein of Homo sapiens amino-terminal enhancer of split (AES), transcript variant 3, 20 µg
View other "Amino terminal enhancer of split" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213043 representing NM_198970
Red=Cloning site Green=Tags(s) MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYG LNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQLQAHQLSQLQALALP LTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_945321 |
Locus ID | 166 |
UniProt ID | Q08117 |
Refseq Size | 1684 |
Cytogenetics | 19p13.3 |
Refseq ORF | 588 |
Synonyms | AES; AES-1; AES-2; ESP1; GRG; Grg-5; GRG5 |
Summary | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404646 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420115 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404646 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 3 |
CNY 3,080.00 |
|
LY420115 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 2 |
CNY 3,080.00 |
|
PH312475 | AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) |
CNY 19,520.00 |
|
PH313043 | AES MS Standard C13 and N15-labeled recombinant protein (NP_945321) |
CNY 14,250.00 |
|
TP312475 | Recombinant protein of human amino-terminal enhancer of split (AES), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Amino terminal enhancer of split产品