United States
Germany
Japan
United Kingdom
China
Paxillin (PXN) (NM_002859) Human Recombinant Protein
CAT＃: TP313811
Recombinant protein of human paxillin (PXN), transcript variant 2, 20 µg
View other "Paxillin" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 2 publications. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213811 representing NM_002859
Red=Cloning site Green=Tags(s) MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQ PSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGS NLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGL EDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKFMA QGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVC THCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEG FHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCE VHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 60.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Pull-down assay (PMID: 27184837) |
| Reference Data | |
| RefSeq | NP_002850 |
| Locus ID | 5829 |
| UniProt ID | P49023 |
| Refseq Size | 3595 |
| Cytogenetics | 12q24.23 |
| Refseq ORF | 1671 |
| Summary | This gene encodes a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. These isoforms exhibit different expression pattern, and have different biochemical, as well as physiological properties (PMID:9054445). [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, VEGF signaling pathway |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Autophagy Promotes Focal Adhesion Disassembly and Cell Motility of Metastatic Tumor Cells through the Direct Interaction of Paxillin with LC3
,Sharifi, MN;Mowers, EE;Drake, LE;Collier, C;Chen, H;Zamora, M;Mui, S;Macleod, KF;,
Cell Rep
,PubMed ID 27184837
[PXN]
|
|
Paxillin and focal adhesion kinase colocalise in human skeletal muscle and its associated microvasculature
,Wilson, OJ;Bradley, H;Shaw, CS;Wagenmakers, AJ;,
Histochem. Cell Biol.
,PubMed ID 24671495
[PXN]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401010 | PXN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC425922 | PXN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429750 | PXN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401010 | Transient overexpression lysate of paxillin (PXN), transcript variant 2 |
CNY 4,840.00 |
|
| LY425922 | Transient overexpression lysate of paxillin (PXN), transcript variant 1 |
CNY 3,080.00 |
|
| LY429750 | Transient overexpression lysate of paxillin (PXN), transcript variant 3 |
CNY 3,080.00 |
|
| PH313811 | PXN MS Standard C13 and N15-labeled recombinant protein (NP_002850) |
CNY 19,520.00 |
|
| TP760834 | Purified recombinant protein of Human paxillin (PXN), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Paxillin产品
