UHRF1 (NM_013282) Human Recombinant Protein
CAT#: TP314251
Recombinant protein of human ubiquitin-like with PHD and ring finger domains 1 (UHRF1), transcript variant 2, 20 µg
View other "UHRF1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214251 representing NM_013282
Red=Cloning site Green=Tags(s) MGVFAVPPLSSDTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHT LFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMW DETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVV QMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLN DCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECD MAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRT KECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFT YTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKY APAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALAN REREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIRED KSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVF SCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 90.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037414 |
Locus ID | 29128 |
UniProt ID | Q96T88 |
Refseq Size | 4086 |
Cytogenetics | 19p13.3 |
Refseq ORF | 2418 |
Synonyms | hNP95; hUHRF1; huNp95; ICBP90; Np95; RNF106; TDRD22 |
Summary | This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12. [provided by RefSeq, Feb 2014] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415692 | UHRF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420780 | UHRF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY415692 | Transient overexpression lysate of ubiquitin-like with PHD and ring finger domains 1 (UHRF1), transcript variant 2 |
CNY 3,080.00 |
|
LY420780 | Transient overexpression lysate of ubiquitin-like with PHD and ring finger domains 1 (UHRF1), transcript variant 1 |
CNY 4,840.00 |
|
PH314251 | UHRF1 MS Standard C13 and N15-labeled recombinant protein (NP_037414) |
CNY 19,520.00 |