ARSB (NM_000046) Human Recombinant Protein
CAT#: TP314604
Recombinant protein of human arylsulfatase B (ARSB), transcript variant 1, 20 µg
View other "ARSB" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 3,600.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214604 representing NM_000046
Red=Cloning site Green=Tags(s) MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSRE YPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000037 |
Locus ID | 411 |
UniProt ID | P15848 |
Refseq Size | 6089 |
Cytogenetics | 5q14.1 |
Refseq ORF | 1599 |
Synonyms | ASB; G4S; MPS6 |
Summary | Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400011 | ARSB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC404825 | ARSB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400011 | Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 1 |
CNY 4,840.00 |
|
LY404825 | Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 2 |
CNY 3,080.00 |
|
PH306565 | ARSB MS Standard C13 and N15-labeled recombinant protein (NP_942002) |
CNY 19,520.00 |
|
PH314604 | ARSB MS Standard C13 and N15-labeled recombinant protein (NP_000037) |
CNY 19,520.00 |
|
TP306565 | Recombinant protein of human arylsulfatase B (ARSB), transcript variant 2, 20 µg |
CNY 2,900.00 |