Amylin (IAPP) (NM_000415) Human Recombinant Protein
CAT#: TP315074
Recombinant protein of human islet amyloid polypeptide precursor (IAPP), 20 µg
View other "Amylin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215074 representing NM_000415
Red=Cloning site Green=Tags(s) MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY GKRNAVEVLKREPLNYLPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 3.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000406 |
Locus ID | 3375 |
UniProt ID | P10997 |
Refseq Size | 1462 |
Cytogenetics | 12p12.1 |
Refseq ORF | 267 |
Synonyms | DAP; IAP |
Summary | This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Maturity onset diabetes of the young |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400146 | IAPP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400146 | Transient overexpression lysate of islet amyloid polypeptide (IAPP) |
CNY 3,080.00 |
|
PH315074 | IAPP MS Standard C13 and N15-labeled recombinant protein (NP_000406) |
CNY 19,520.00 |