Adiponectin (ADIPOQ) (NM_004797) Human Recombinant Protein
CAT#: TP315161
Recombinant protein of human adiponectin, C1Q and collagen domain containing (ADIPOQ), 20 µg
View other "Adiponectin" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215161 representing NM_004797
Red=Cloning site Green=Tags(s) MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGD PGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQ NHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQ VWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004788 |
Locus ID | 9370 |
UniProt ID | Q15848, A8K660 |
Refseq Size | 4592 |
Cytogenetics | 3q27.3 |
Refseq ORF | 732 |
Synonyms | ACDC; ACRP30; ADIPQTL1; ADPN; APM-1; APM1; GBP28 |
Summary | This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Adipocytokine signaling pathway, PPAR signaling pathway, Type II diabetes mellitus |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Brain adiponectin signaling controls peripheral insulin response in Drosophila
,null,
Nature Communications
,PubMed ID 34561451
[ADIPOQ]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401510 | ADIPOQ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432756 | ADIPOQ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401510 | Transient overexpression lysate of adiponectin, C1Q and collagen domain containing (ADIPOQ) |
CNY 3,080.00 |
|
LY432756 | Transient overexpression lysate of adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 1 |
CNY 3,080.00 |
|
PH315161 | ADIPOQ MS Standard C13 and N15-labeled recombinant protein (NP_004788) |
CNY 19,520.00 |
|
TP700247 | Purified secreted form of human adiponectin, C1Q and collagen domain containing (ADIPOQ), with N-terminal His tag, expressed in human cells, 20ug |
CNY 6,650.00 |
|
TP710245 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP710246 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, residues 18-244aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP720685 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2 |
CNY 3,140.00 |
|
TP790074 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, esidues 19-244aa, with C-terminal DDK tag, secretory expressed in CHO cells, 50ug |
CNY 3,900.00 |
其它Adiponectin产品