DUSP4 (NM_057158) Human Recombinant Protein
CAT#: TP315252
Recombinant protein of human dual specificity phosphatase 4 (DUSP4), transcript variant 2, 20 µg
View other "DUSP4" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215252 representing NM_057158
Red=Cloning site Green=Tags(s) MGRKVHSNGSQFAEHSRSPRRTGRDCKPVRAPSMALGVSQLAGRSRCLCSESQGGYERFSSEYPEFCSKT KALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSD CPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKRV RLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVS VGVHSAPSSLPYLHSPITTSPSC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_476499 |
Locus ID | 1846 |
UniProt ID | Q13115 |
Refseq Size | 3404 |
Cytogenetics | 8p12 |
Refseq ORF | 909 |
Synonyms | HVH2; MKP-2; MKP2; TYP |
Summary | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Phosphatase |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400543 | DUSP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403296 | DUSP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400543 | Transient overexpression lysate of dual specificity phosphatase 4 (DUSP4), transcript variant 1 |
CNY 3,080.00 |
|
LY403296 | Transient overexpression lysate of dual specificity phosphatase 4 (DUSP4), transcript variant 2 |
CNY 3,080.00 |
|
PH300640 | DUSP4 MS Standard C13 and N15-labeled recombinant protein (NP_001385) |
CNY 19,520.00 |
|
PH315252 | DUSP4 MS Standard C13 and N15-labeled recombinant protein (NP_476499) |
CNY 19,520.00 |
|
TP300640 | Recombinant protein of human dual specificity phosphatase 4 (DUSP4), transcript variant 1, 20 µg |
CNY 2,900.00 |