Livin (BIRC7) (NM_022161) Human Recombinant Protein
CAT#: TP315363
Recombinant protein of human baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2, 20 µg
View other "Livin" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215363 representing NM_022161
Red=Cloning site Green=Tags(s) MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEG AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDP WTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQS ESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071444 |
Locus ID | 79444 |
UniProt ID | Q96CA5 |
Refseq Size | 1268 |
Cytogenetics | 20q13.33 |
Refseq ORF | 840 |
Synonyms | KIAP; LIVIN; ML-IAP; MLIAP; RNF50 |
Summary | This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Elevated levels of the encoded protein may be associated with cancer progression and play a role in chemotherapy sensitivity. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403386 | BIRC7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411731 | BIRC7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403386 | Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 1 |
CNY 3,080.00 |
|
LY411731 | Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2 |
CNY 3,080.00 |
|
PH304906 | BIRC7 MS Standard C13 and N15-labeled recombinant protein (NP_647478) |
CNY 19,520.00 |
|
PH315363 | BIRC7 MS Standard C13 and N15-labeled recombinant protein (NP_071444) |
CNY 19,520.00 |
|
TP304906 | Recombinant protein of human baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 1, 20 µg |
CNY 2,900.00 |