GCET2 (GCSAM) (NM_001008756) Human Recombinant Protein

CAT#: TP315443M

Recombinant protein of human germinal center expressed transcript 2 (GCET2), transcript variant 2, 100 µg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 9,998.00


货期*
4周

规格
    • 100 ug

Product images

经常一起买 (3)
Rabbit Polyclonal Anti-GCSAM Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC215443 representing NM_001008756
Red=Cloning site Green=Tags(s)

MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSST
PIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRH
ARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001008756
Locus ID 257144
UniProt ID Q8N6F7
Refseq Size 3481
Cytogenetics 3q13.2
Refseq ORF 339
Synonyms GCAT2; germinal center-associated lymphoma; germinal center B cell associated-protein 2; germinal center expressed transcript 2; HGAL; MGC40441
Summary This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...