Glutaredoxin 2 (GLRX2) (NM_016066) Human Recombinant Protein
CAT#: TP315566
Recombinant protein of human glutaredoxin 2 (GLRX2), transcript variant 1, 20 µg
View other "Glutaredoxin 2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215566 representing NM_016066
Red=Cloning site Green=Tags(s) MNPRDKQVSRFSPLKDVYTWVALAGIQRSGSPGRTRSAARRMESNTSSSLENLATAPVNQIQETISDNCV VIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHR LHKEGKLLPLVHQCYLKKSKRKEFQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057150 |
Locus ID | 51022 |
UniProt ID | Q9NS18 |
Refseq Size | 1170 |
Cytogenetics | 1q31.2 |
Refseq ORF | 495 |
Synonyms | CGI-133; GRX2 |
Summary | The protein encoded by this gene is a member of the glutaredoxin family of proteins, which maintain cellular thiol homeostasis. These proteins are thiol-disulfide oxidoreductases that use a glutathione-binding site and one or two active cysteines in their active site. This gene undergoes alternative splicing to produce multiple isoforms, one of which is ubiquitously expressed and localizes to mitochondria, where it functions in mitochondrial redox homeostasis and is important for the protection against and recovery from oxidative stress. Other isoforms, which have more restrictive expression patterns, show cytosolic and nuclear localization, and are thought to function in cellular differentiation and transformation, possibly with a role in tumor progression. [provided by RefSeq, Aug 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414214 | GLRX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414214 | Transient overexpression lysate of glutaredoxin 2 (GLRX2), transcript variant 1 |
CNY 3,080.00 |
|
PH315566 | GLRX2 MS Standard C13 and N15-labeled recombinant protein (NP_057150) |
CNY 19,520.00 |
其它Glutaredoxin 2产品