ADRM1 (NM_007002) Human Recombinant Protein
CAT#: TP315635
Recombinant protein of human adhesion regulating molecule 1 (ADRM1), transcript variant 1, 20 µg
View other "ADRM1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215635 representing NM_007002
Red=Cloning site Green=Tags(s) MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVE DDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGAS GSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSR SQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGP AGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASG QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008933 |
Locus ID | 11047 |
UniProt ID | Q16186 |
Refseq Size | 1410 |
Cytogenetics | 20q13.33 |
Refseq ORF | 1221 |
Synonyms | ARM-1; ARM1; GP110; PSMD16 |
Summary | This gene encodes a member of the adhesion regulating molecule 1 protein family. The encoded protein is a component of the proteasome where it acts as a ubiquitin receptor and recruits the deubiquitinating enzyme, ubiquitin carboxyl-terminal hydrolase L5. Increased levels of the encoded protein are associated with increased cell adhesion, which is likely an indirect effect of this intracellular protein. Dysregulation of this gene has been implicated in carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402072 | ADRM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406279 | ADRM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402072 | Transient overexpression lysate of adhesion regulating molecule 1 (ADRM1), transcript variant 1 |
CNY 3,080.00 |
|
LY406279 | Transient overexpression lysate of adhesion regulating molecule 1 (ADRM1), transcript variant 2 |
CNY 3,080.00 |
|
PH305671 | ADRM1 MS Standard C13 and N15-labeled recombinant protein (NP_783163) |
CNY 19,520.00 |
|
PH315635 | ADRM1 MS Standard C13 and N15-labeled recombinant protein (NP_008933) |
CNY 19,520.00 |
|
TP305671 | Recombinant protein of human adhesion regulating molecule 1 (ADRM1), transcript variant 2, 20 µg |
CNY 2,900.00 |