AIF1L (NM_031426) Human Recombinant Protein
CAT#: TP315825L
Recombinant protein of human allograft inflammatory factor 1-like (AIF1L), transcript variant 1, 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215825 representing NM_031426
Red=Cloning site Green=Tags(s) MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLM SLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGP PPERDIASLP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_113614 |
Locus ID | 83543 |
UniProt ID | Q9BQI0 |
Refseq Size | 3406 |
Cytogenetics | 9q34.12-q34.13 |
Refseq ORF | 450 |
Synonyms | C9orf58; IBA2 |
Summary | Actin-binding protein that promotes actin bundling. May neither bind calcium nor depend on calcium for function.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |