CARD9 (NM_052813) Human Recombinant Protein
CAT#: TP315899
Recombinant protein of human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 20 µg
View other "CARD9" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215899 representing NM_052813
Red=Cloning site Green=Tags(s) MSDYENDDECWNVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR TGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSK DDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEI DQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYI QVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQM EEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEK ERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 62.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_434700 |
Locus ID | 64170 |
UniProt ID | Q9H257 |
Refseq Size | 2136 |
Cytogenetics | 9q34.3 |
Refseq ORF | 1608 |
Synonyms | CANDF2; hCARD9 |
Summary | The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409473 | CARD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429892 | CARD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409473 | Transient overexpression lysate of caspase recruitment domain family, member 9 (CARD9), transcript variant 1 |
CNY 4,840.00 |
|
LY429892 | Transient overexpression lysate of caspase recruitment domain family, member 9 (CARD9), transcript variant 2 |
CNY 3,080.00 |
|
PH315899 | CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434700) |
CNY 19,520.00 |
|
PH325844 | CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434701) |
CNY 19,520.00 |
|
TP325844 | Recombinant protein of human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 20 µg |
CNY 2,900.00 |