BHLHA15 (NM_177455) Human Recombinant Protein
CAT#: TP315938
Recombinant protein of human basic helix-loop-helix family, member a15 (BHLHA15), 20 µg
View other "BHLHA15" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215938 representing NM_177455
Red=Cloning site Green=Tags(s) MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRRPGPSGPGGRR DSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLP GLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREGT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_803238 |
Locus ID | 168620 |
UniProt ID | Q7RTS1 |
Refseq Size | 588 |
Cytogenetics | 7q21.3 |
Refseq ORF | 567 |
Synonyms | BHLHB8; MIST1 |
Summary | Plays a role in controlling the transcriptional activity of MYOD1, ensuring that expanding myoblast populations remain undifferentiated. Repression may occur through muscle-specific E-box occupancy by homodimers. May also negatively regulate bHLH-mediated transcription through an N-terminal repressor domain. Serves as a key regulator of acinar cell function, stability, and identity. Also required for normal organelle localization in exocrine cells and for mitochondrial calcium ion transport. May function as a unique regulator of gene expression in several different embryonic and postnatal cell lineages. Binds to the E-box consensus sequence 5'-CANNTG-3' (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Maturity onset diabetes of the young |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406171 | BHLHA15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406171 | Transient overexpression lysate of basic helix-loop-helix family, member a15 (BHLHA15) |
CNY 3,080.00 |
|
PH315938 | BHLHA15 MS Standard C13 and N15-labeled recombinant protein (NP_803238) |
CNY 14,250.00 |
其它BHLHA15产品