POU4F2 (NM_004575) Human Recombinant Protein
CAT#: TP315962
Purified recombinant protein of Homo sapiens POU class 4 homeobox 2 (POU4F2), 20 µg
View other "POU4F2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215962 representing NM_004575
Red=Cloning site Green=Tags(s) MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGGGGGGGGGGGR SSSSSSSGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQSKSHHHHPPHHSPFKPD ATYHTMNTIPCTSAASSSSVPISHPCALAGTHHHHHHHHHHHHQPHQALEGELLEHLSPGLALGAMAGPD GAVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADV GSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKR TSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004566 |
Locus ID | 5458 |
UniProt ID | Q12837 |
Refseq Size | 3110 |
Cytogenetics | 4q31.22 |
Refseq ORF | 1230 |
Synonyms | Brn-3b; BRN3.2; BRN3B |
Summary | The protein encoded by this gene is a member of the POU-domain transcription factor family and may be involved in maintaining visual system neurons in the retina. The level of the encoded protein is also elevated in a majority of breast cancers, resulting in accelerated tumor growth. [provided by RefSeq, Sep 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417894 | POU4F2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417894 | Transient overexpression lysate of POU class 4 homeobox 2 (POU4F2) |
CNY 3,080.00 |
|
PH315962 | POU4F2 MS Standard C13 and N15-labeled recombinant protein (NP_004566) |
CNY 14,250.00 |