P2X2 (P2RX2) (NM_170682) Human Recombinant Protein
CAT#: TP316207
Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 1, 20 µg
View other "P2X2" proteins (18)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216207 representing NM_170682
Red=Cloning site Green=Tags(s) MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQES ETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDA DCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAPNFTILIKNSIHYPKFHF SKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECN PKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALT SVGVGSFLCDWILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSG QEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_733782 |
Locus ID | 22953 |
UniProt ID | Q9UBL9 |
Refseq Size | 1830 |
Cytogenetics | 12q24.33 |
Refseq ORF | 1413 |
Synonyms | DFNA41; P2X2 |
Summary | The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome, Ion Channels: ATP Receptors, Transmembrane |
Protein Pathways | Calcium signaling pathway, Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403528 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC406287 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406792 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC414051 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC415901 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430303 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430413 | P2RX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403528 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 1 |
CNY 4,840.00 |
|
LY406287 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 5 |
CNY 3,080.00 |
|
LY406792 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 4 |
CNY 4,840.00 |
|
LY414051 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 3 |
CNY 4,840.00 |
|
LY415901 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 6 |
CNY 3,080.00 |
|
LY430303 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 4 |
CNY 3,080.00 |
|
LY430413 | Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 5 |
CNY 3,080.00 |
|
PH316207 | P2RX2 MS Standard C13 and N15-labeled recombinant protein (NP_733782) |
CNY 19,520.00 |
|
TP700189 | Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), V60L mutant of transcript variant 1, 20 ug |
CNY 6,650.00 |
|
TP700190 | Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), K81A mutant of transcript variant 1, 20 ug |
CNY 6,650.00 |
|
TP700191 | Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), G353R mutant of transcript variant 1, 20 ug |
CNY 6,650.00 |