PHR1 (PLEKHB1) (NM_021200) Human Recombinant Protein
CAT#: TP316627
Recombinant protein of human pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 1, 20 µg
View other "PHR1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216627 representing NM_021200
Red=Cloning site Green=Tags(s) MSPAAPVPPDSALESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHF NVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRLHLCAETKDDALAWKTALLEANSTPAPAGATVPPR SRRVCSKVRCVTRSWSPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTHVIVRED PCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067023 |
Locus ID | 58473 |
UniProt ID | Q9UF11 |
Refseq Size | 2402 |
Cytogenetics | 11q13.4 |
Refseq ORF | 729 |
Synonyms | KPL1; PHR1; PHRET1 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412039 | PLEKHB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427118 | PLEKHB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412039 | Transient overexpression lysate of pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 1 |
CNY 3,080.00 |
|
LY427118 | Transient overexpression lysate of pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 4 |
CNY 3,080.00 |
|
PH316627 | PLEKHB1 MS Standard C13 and N15-labeled recombinant protein (NP_067023) |
CNY 19,520.00 |
|
PH325204 | PLEKHB1 MS Standard C13 and N15-labeled recombinant protein (NP_001123507) |
CNY 14,250.00 |
|
TP325204 | Purified recombinant protein of Homo sapiens pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 4, 20 µg |
CNY 2,900.00 |