APRT (NM_000485) Human Recombinant Protein
CAT#: TP316874
Recombinant protein of human adenine phosphoribosyltransferase (APRT), transcript variant 1, 20 µg
View other "APRT" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216874 protein sequence
Red=Cloning site Green=Tags(s) MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFL FGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAAC ELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000476 |
Locus ID | 353 |
UniProt ID | P07741 |
Refseq Size | 807 |
Cytogenetics | 16q24.3 |
Refseq ORF | 540 |
Synonyms | AMP; APRTD |
Summary | Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422236 | APRT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424695 | APRT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425509 | APRT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422236 | Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 2 |
CNY 3,080.00 |
|
LY424695 | Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 1 |
CNY 3,080.00 |
|
PH316874 | APRT MS Standard C13 and N15-labeled recombinant protein (NP_000476) |
CNY 19,520.00 |