CARHSP1 (NM_001042476) Human Recombinant Protein
CAT#: TP317744
Recombinant protein of human calcium regulated heat stable protein 1, 24kDa (CARHSP1), transcript variant 2, 20 µg
View other "CARHSP1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 6,281.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217744 representing NM_001042476
Red=Cloning site Green=Tags(s) MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCF CRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETW SGHVISS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035941 |
Locus ID | 23589 |
UniProt ID | Q9Y2V2 |
Refseq Size | 3029 |
Cytogenetics | 16p13.2 |
Refseq ORF | 441 |
Synonyms | CRHSP-24; CRHSP24; CSDC1 |
Summary | Binds mRNA and regulates the stability of target mRNA. Binds single-stranded DNA (in vitro).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415360 | CARHSP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420930 | CARHSP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425754 | CARHSP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415360 | Transient overexpression lysate of calcium regulated heat stable protein 1, 24kDa (CARHSP1), transcript variant 1 |
CNY 3,080.00 |
|
LY420930 | Transient overexpression lysate of calcium regulated heat stable protein 1, 24kDa (CARHSP1), transcript variant 2 |
CNY 3,080.00 |
|
PH317744 | CARHSP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035941) |
CNY 19,520.00 |
其它CARHSP1产品