MST3 (STK24) (NM_003576) Human Recombinant Protein
CAT#: TP317776
Recombinant protein of human serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1, 20 µg
View other "MST3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217776 representing NM_003576
Red=Cloning site Green=Tags(s) MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLE EAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREI LKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQLAYDS KADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKEL LKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLE NGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISD TMVAQLVQRLQRYSLSGGGTSSH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003567 |
Locus ID | 8428 |
UniProt ID | Q9Y6E0 |
Refseq Size | 4539 |
Cytogenetics | 13q32.2 |
Refseq ORF | 1329 |
Synonyms | HEL-S-95; MST3; MST3B; STE20; STK3 |
Summary | This gene encodes a serine/threonine protein kinase that functions upstream of mitogen-activated protein kinase (MAPK) signaling. The encoded protein is cleaved into two chains by caspases; the N-terminal fragment (MST3/N) translocates to the nucleus and promotes programmed cells death. There is a pseudogene for this gene on chromosome X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418583 | STK24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422305 | STK24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418583 | Transient overexpression lysate of serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1 |
CNY 4,840.00 |
|
LY422305 | Transient overexpression lysate of serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 2 |
CNY 3,080.00 |
|
PH317776 | STK24 MS Standard C13 and N15-labeled recombinant protein (NP_003567) |
CNY 19,520.00 |