AMPK alpha 1 (PRKAA1) (NM_006251) Human Recombinant Protein
CAT#: TP318572
Recombinant protein of human protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 1, 20 µg
View other "AMPK alpha 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218572 representing NM_006251
Red=Cloning site Green=Tags(s) MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVG KIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDY CHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWS SGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFK QDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKD FYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTAT PQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006242 |
Locus ID | 5562 |
UniProt ID | Q13131 |
Refseq Size | 5085 |
Cytogenetics | 5p13.1 |
Refseq ORF | 1677 |
Synonyms | AMPK; AMPKa1; AMPK alpha 1 |
Summary | The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Adipocytokine signaling pathway, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway, mTOR signaling pathway, Regulation of autophagy |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Re-sensitization of radiation resistant colorectal cancer cells to radiation through inhibition of AMPK pathway
,null,
Oncology Letters
,PubMed ID 27123089
[PRKAA1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404162 | PRKAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC416771 | PRKAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY404162 | Transient overexpression lysate of protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 2 |
CNY 4,840.00 |
|
LY416771 | Transient overexpression lysate of protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 1 |
CNY 4,840.00 |
|
PH318572 | PRKAA1 MS Standard C13 and N15-labeled recombinant protein (NP_006242) |
CNY 19,520.00 |
其它AMPK alpha 1产品