United States
Germany
Japan
United Kingdom
China
RANKL (TNFSF11) (NM_003701) Human Recombinant Protein
CAT＃: TP318782
Purified recombinant protein of Homo sapiens tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1, 20 µg
View other "RANKL" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218782 representing NM_003701
Red=Cloning site Green=Tags(s) MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYF RAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHI RAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQ DGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGF FKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 35.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003692 |
| Locus ID | 8600 |
| UniProt ID | O14788 |
| Refseq Size | 2226 |
| Cytogenetics | 13q14.11 |
| Refseq ORF | 951 |
| Synonyms | CD254; hRANKL2; ODF; OPGL; OPTB2; RANKL; sOdf; TNLG6B; TRANCE |
| Summary | This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401221 | TNFSF11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403220 | TNFSF11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401221 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1 |
CNY 3,080.00 |
|
| LY403220 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 2 |
CNY 3,080.00 |
|
| PH318782 | TNFSF11 MS Standard C13 and N15-labeled recombinant protein (NP_003692) |
CNY 14,250.00 |
|
| PH324778 | TNFSF11 MS Standard C13 and N15-labeled recombinant protein (NP_143026) |
CNY 19,520.00 |
|
| TP324778 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP723867 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11 / RANKL), transcript variant 1 |
CNY 5,240.00 |
Rabbit anti-TNFSF11 Polyclonal Antibody
热销推荐
