bcl 6 (BCL6) (NM_001706) Human Recombinant Protein
CAT#: TP319007
Recombinant protein of human B-cell CLL/lymphoma 6 (BCL6), transcript variant 1, 20 µg
View other "bcl 6" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219007 representing NM_001706
Red=Cloning site Green=Tags(s) MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLS VINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPR EEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSD EEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEG LKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS KNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCL HTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGN LASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPY PCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP ELPKAC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 78.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001697 |
Locus ID | 604 |
UniProt ID | P41182 |
Refseq Size | 3537 |
Cytogenetics | 3q27.3 |
Refseq ORF | 2118 |
Synonyms | BCL5; BCL6A; LAZ3; ZBTB27; ZNF51 |
Summary | The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Aug 2015] |
Protein Families | Druggable Genome, Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
PRMT5 interacts with the BCL6 oncoprotein and is required for germinal center formation and lymphoma cell survival
,Lu, X;Fernando, T;Lossos, C;Yusufova, N;Liu, F;Fontán, L;Durant, M;Geng, H;Melnick, J;Luo, Y;Vega, F;Moy, V;Inghirami, G;Nimer, S;Melnick, AM;Lossos, IS;,
Blood
,PubMed ID 30082494
[BCL6]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400639 | BCL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC427282 | BCL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400639 | Transient overexpression lysate of B-cell CLL/lymphoma 6 (BCL6), transcript variant 1 |
CNY 4,840.00 |
|
LY427282 | Transient overexpression lysate of B-cell CLL/lymphoma 6 (BCL6), transcript variant 2 |
CNY 4,840.00 |
|
PH319007 | BCL6 MS Standard C13 and N15-labeled recombinant protein (NP_001697) |
CNY 19,520.00 |
|
TP750190 | Purified recombinant protein of Human B-cell CLL/lymphoma 6 (BCL6), transcript variant 1, Ser209-Pro292, tag free, expressed in E.coli, 50ug |
CNY 2,840.00 |