United States
Germany
Japan
United Kingdom
China
hnRNP K (HNRNPK) (NM_031263) Human Recombinant Protein
CAT＃: TP319023
Recombinant protein of human heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 2, 20 µg
View other "hnRNP K" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219023 protein sequence
Red=Cloning site Green=Tags(s) METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRT DYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKG SDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIIL DLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDY DDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAID TWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 50.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_112553 |
| Locus ID | 3190 |
| UniProt ID | P61978 |
| Refseq Size | 2960 |
| Cytogenetics | 9q21.32 |
| Refseq ORF | 1392 |
| Synonyms | AUKS; CSBP; HNRPK; TUNP |
| Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference; it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Several alternatively spliced transcript variants have been described for this gene, however, not all of them are fully characterized. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400779 | HNRNPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410602 | HNRNPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410603 | HNRNPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400779 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 1 |
CNY 3,080.00 |
|
| LY410602 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 3 |
CNY 3,080.00 |
|
| LY410603 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 2 |
CNY 3,080.00 |
|
| PH301843 | HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_002131) |
CNY 19,520.00 |
|
| PH304921 | HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_112552) |
CNY 19,520.00 |
|
| PH319023 | HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_112553) |
CNY 19,520.00 |
|
| TP301843 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP304921 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它hnRNP K产品
