Nucleolin (NCL) (NM_005381) Human Recombinant Protein

CAT#: TP319082

Recombinant protein of human nucleolin (NCL), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "Nucleolin" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
现货

规格
    • 20 ug

Cited in 12 publications.
经常一起买 (3)
Rabbit Polyclonal Nucleolin Antibody
    • 100 ul

CNY 5,381.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC219082 representing NM_005381
Red=Cloning site Green=Tags(s)

MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTK
KVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNA
KKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEA
METTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKR
KKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFG
YVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVL
SNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGP
RGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAM
EDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDH
KPQGKKTKFE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 76.4 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Bioactivity EMSA reaction positive control (PMID: 26354862)
Taq polymerase assay (regulator) (PMID: 26354862)
Binding assay (Dimethylsulfate footprinting) (PMID: 26354862)
Binding assay (FRET) (PMID: 26354862)
Surface Plasmon Ressonance (SPR) (PMID: 26354862)
Association in cell culture (PMID: 26707270)
Surface Plasmon Ressonance (SPR) (PMID: 27032748)
EMSA reaction positive control (PMID: 27913192)
ELISA binding assay (PMID: 28974366)
Reference Data
RefSeq NP_005372
Locus ID 4691
UniProt ID P19338
Refseq Size 2732
Cytogenetics 2q37.1
Refseq ORF 2130
Synonyms C23; Nsr1
Summary Nucleolin (NCL), a eukaryotic nucleolar phosphoprotein, is involved in the synthesis and maturation of ribosomes. It is located mainly in dense fibrillar regions of the nucleolus. Human NCL gene consists of 14 exons with 13 introns and spans approximately 11kb. The intron 11 of the NCL gene encodes a small nucleolar RNA, termed U20. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Pathogenic Escherichia coli infection
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (12)

Documents

Other Versions

Customer Reviews 
Loading...