United States
Germany
Japan
United Kingdom
China
ENO3 (NM_001976) Human Recombinant Protein
CAT＃: TP319257
Recombinant protein of human enolase 3 (beta, muscle) (ENO3), transcript variant 1, 20 µg
View other "ENO3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219257 representing NM_001976
Red=Cloning site Green=Tags(s) MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN NTLGPALLQKKLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGN PDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDE GGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSV TESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK AIFAGRKFRNPKAK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001967 |
| Locus ID | 2027 |
| UniProt ID | P13929 |
| Refseq Size | 1494 |
| Cytogenetics | 17p13.2 |
| Refseq ORF | 1302 |
| Synonyms | GSD13; MSE |
| Summary | This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Jul 2010] |
| Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409322 | ENO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419609 | ENO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434201 | ENO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409322 | Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 2 |
CNY 3,080.00 |
|
| LY419609 | Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 1 |
CNY 3,080.00 |
|
| LY434201 | Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 3 |
CNY 3,080.00 |
|
| PH305684 | ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_443739) |
CNY 14,250.00 |
|
| PH319257 | ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_001967) |
CNY 14,250.00 |
|
| TP305684 | Recombinant protein of human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 20 µg |
CNY 2,900.00 |
