IL36 alpha (IL36A) (NM_014440) Human Recombinant Protein
CAT#: TP319328L
Recombinant protein of human interleukin 1 family, member 6 (epsilon) (IL1F6), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219328 protein sequence
Red=Cloning site Green=Tags(s) MEKALKIDTPQRGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGL NLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLIL TQELGKANTTDFGLTMLF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055255 |
Locus ID | 27179 |
UniProt ID | Q9UHA7 |
Refseq Size | 477 |
Cytogenetics | 2q14.1 |
Refseq ORF | 475 |
Synonyms | FIL1; FIL1(EPSILON); FIL1E; IL-1F6; IL1(EPSILON); IL1F6 |
Summary | The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
其它IL36 alpha产品