TIA1 (NM_022173) Human Recombinant Protein
CAT#: TP319386
Recombinant protein of human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, 20 µg
View other "TIA1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 2 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219386 representing NM_022173
Red=Cloning site Green=Tags(s) MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRK IMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKD MATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSS PSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVK CYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSS APWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071505 |
Locus ID | 7072 |
UniProt ID | P31483 |
Refseq Size | 2390 |
Cytogenetics | 2p13.3 |
Refseq ORF | 1158 |
Synonyms | ALS26; TIA-1; WDM |
Summary | The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms has been found for this gene. [provided by RefSeq, May 2017] |
Protein Families | Druggable Genome |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Analysis of RNA-protein networks with RNP-MaP defines functional hubs on RNA
,Weidmann, CA;Mustoe, AM;Jariwala, PB;Calabrese, JM;Weeks, KM;,
Nat Biotechnol
,PubMed ID 33077962
[TIA1]
|
RNP-MaP: In-cell analysis of protein interaction networks defines functional hubs in RNA
,Weidmann, CA;Mustoe, AM;Jariwala, PB;Calabrese, JM;,
bioRxiv
[TIA1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411728 | TIA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411728 | Transient overexpression lysate of TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2 |
CNY 3,080.00 |
|
PH319386 | TIA1 MS Standard C13 and N15-labeled recombinant protein (NP_071505) |
CNY 19,520.00 |
|
TP762405 | Purified recombinant protein of Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, Val279-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |