NDRG2 (NM_201535) Human Recombinant Protein
CAT#: TP319812
Purified recombinant protein of Homo sapiens NDRG family member 2 (NDRG2), transcript variant 1, 20 µg
View other "NDRG2" proteins (30)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219812 representing NM_201535
Red=Cloning site Green=Tags(s) MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHD VGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDELADMIPCVLQYLNFSTI IGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGN SELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDP TRTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLS QSSESGTLSSGPPGHTMEVSC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_963293 |
Locus ID | 57447 |
UniProt ID | Q9UN36 |
Refseq Size | 2142 |
Cytogenetics | 14q11.2 |
Refseq ORF | 1113 |
Synonyms | SYLD |
Summary | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404442 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404443 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404444 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404445 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404446 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404447 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404448 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414093 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404442 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 1 |
CNY 3,080.00 |
|
LY404443 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 3 |
CNY 3,080.00 |
|
LY404444 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 4 |
CNY 3,080.00 |
|
LY404445 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 5 |
CNY 3,080.00 |
|
LY404446 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 6 |
CNY 3,080.00 |
|
LY404447 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 7 |
CNY 3,080.00 |
|
LY404448 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 8 |
CNY 3,080.00 |
|
LY414093 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 2 |
CNY 3,080.00 |
|
PH303712 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963832) |
CNY 19,520.00 |
|
PH310598 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963835) |
CNY 19,520.00 |
|
PH311577 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_057334) |
CNY 19,520.00 |
|
PH312237 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963831) |
CNY 19,520.00 |
|
PH314708 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963834) |
CNY 14,250.00 |
|
PH319812 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963293) |
CNY 14,250.00 |
|
PH320003 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963833) |
CNY 14,250.00 |
|
TP303712 | Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP310598 | Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 8, 20 µg |
CNY 2,900.00 |
|
TP311577 | Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP312237 | Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP314708 | Purified recombinant protein of Homo sapiens NDRG family member 2 (NDRG2), transcript variant 7, 20 µg |
CNY 2,900.00 |
|
TP320003 | Purified recombinant protein of Homo sapiens NDRG family member 2 (NDRG2), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
TP760733 | Purified recombinant protein of Human NDRG family member 2 (NDRG2), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |