SBSN (NM_198538) Human Recombinant Protein
CAT#: TP319831
Recombinant protein of human suprabasin (SBSN), 20 µg
View other "SBSN" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219831 representing NM_198538
Red=Cloning site Green=Tags(s) MHLARLVGSCSLLLLLGALSGWAASDDPIEKVIEGINRGLSNAEREVGKALDGINSGITHAGREVEKVFN GLSNMGSHTGKELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTG VHQAGKEAEKLGQGVNHAADQAGKEVEKLGQGAHHAAGQAGKELQNAHNGVNQASKEANQLLNGNHQSGS SSHQGGATTTPLASGASVNTPFINLPALWRSVANIMP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_940940 |
Locus ID | 374897 |
UniProt ID | Q6UWP8 |
Refseq Size | 957 |
Cytogenetics | 19q13.12 |
Refseq ORF | 741 |
Synonyms | UNQ698 |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Sox2 induces tumorigenesis and angiogenesis of early stage esophagealsquamous cell carcinoma through secretion of Suprabasin
,Takahashi, K;Asano, N;Imatani, A;Kondo, Y;Saito, M;Takeuchi, A;Jin, X;Saito, M;Hatta, W;Asanuma, K;Uno, K;Koike, T;Masamune, A;,
Carcinogenesis
,PubMed ID 32055838
[SBSN]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404842 | SBSN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431506 | SBSN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404842 | Transient overexpression lysate of suprabasin (SBSN), transcript variant 2 |
CNY 3,080.00 |
|
LY431506 | Transient overexpression lysate of suprabasin (SBSN), transcript variant 1 |
CNY 3,080.00 |
|
PH319831 | SBSN MS Standard C13 and N15-labeled recombinant protein (NP_940940) |
CNY 19,520.00 |