LASP1 (NM_006148) Human Recombinant Protein
CAT#: TP319975
Recombinant protein of human LIM and SH3 protein 1 (LASP1), 20 µg
View other "LASP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219975 representing NM_006148
Red=Cloning site Green=Tags(s) MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006139 |
Locus ID | 3927 |
UniProt ID | Q14847 |
Refseq Size | 3846 |
Cytogenetics | 17q12 |
Refseq ORF | 783 |
Synonyms | Lasp-1; MLN50 |
Summary | This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer. [provided by RefSeq, Oct 2012] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A naturally-monomeric infrared fluorescent protein for protein labeling in vivo
,null,
Nature methods
,PubMed ID 26098020
[LASP1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416835 | LASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416835 | Transient overexpression lysate of LIM and SH3 protein 1 (LASP1) |
CNY 3,080.00 |
|
PH319975 | LASP1 MS Standard C13 and N15-labeled recombinant protein (NP_006139) |
CNY 19,520.00 |