gamma Sarcoglycan (SGCG) (NM_000231) Human Recombinant Protein
CAT#: TP320093
Recombinant protein of human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), 20 µg
View other "gamma Sarcoglycan" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220093 protein sequence
Red=Cloning site Green=Tags(s) MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGH LCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQF QINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVH IQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVS TTCQEHSHICL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000222 |
Locus ID | 6445 |
UniProt ID | Q13326 |
Refseq Size | 1661 |
Cytogenetics | 13q12.12 |
Refseq ORF | 873 |
Synonyms | 35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG; LGMD2C; LGMDR5; MAM; SCARMD2; SCG3 |
Summary | This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424852 | SGCG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424852 | Transient overexpression lysate of sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG) |
CNY 3,080.00 |
|
PH320093 | SGCG MS Standard C13 and N15-labeled recombinant protein (NP_000222) |
CNY 19,520.00 |
其它gamma Sarcoglycan产品