TMEPAI (PMEPA1) (NM_199170) Human Recombinant Protein
CAT#: TP320162
Recombinant protein of human prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 3, 20 µg
View other "TMEPAI" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220162 representing NM_199170
Red=Cloning site Green=Tags(s) MMVMVVVITCLLSHYKLSARSFISRHSQGRRREDALSSEGCLWPSESTVSGNGIPEPQVYAPPRPTDRLA VPPFAQRERFHRFQPTYPYLQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRT IFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTR LHHTHIAPLESAAIWSKEKDKQKGHPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_954639 |
Locus ID | 56937 |
UniProt ID | Q969W9 |
Refseq Size | 4531 |
Cytogenetics | 20q13.31 |
Refseq ORF | 711 |
Synonyms | STAG1; TMEPAI |
Summary | This gene encodes a transmembrane protein that contains a Smad interacting motif (SIM). Expression of this gene is induced by androgens and transforming growth factor beta, and the encoded protein suppresses the androgen receptor and transforming growth factor beta signaling pathways though interactions with Smad proteins. Overexpression of this gene may play a role in multiple types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404671 | PMEPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404672 | PMEPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412605 | PMEPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404671 | Transient overexpression lysate of prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 3 |
CNY 3,080.00 |
|
LY404672 | Transient overexpression lysate of prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 4 |
CNY 3,080.00 |
|
LY412605 | Transient overexpression lysate of prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 1 |
CNY 3,080.00 |
|
PH310261 | PMEPA1 MS Standard C13 and N15-labeled recombinant protein (NP_954640) |
CNY 19,520.00 |
|
PH320162 | PMEPA1 MS Standard C13 and N15-labeled recombinant protein (NP_954639) |
CNY 19,520.00 |
|
TP310261 | Recombinant protein of human prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 4, 20 µg |
CNY 2,900.00 |